missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rat Tpc1808 Protein
A cDNA sequence encoding the Tpc1808 was constructed and used to recombinantly synthesize the protein.
Marca: enQuireBio™ QP13791-1mg
Detalles adicionales : Peso : 0.01000kg
Especificaciones
| Tpc1808 Protein | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS | |
| Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| 1 mg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Rat | |
| His | |
| The Tropic-1808 was lyophilized from 1X PBS, pH 7.4. |