missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat CNTF Protein

A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10559-25ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15924248

  • 160.00€ / 25 microgramos


Fecha de envío estimada
del proveedor 10-04-2019
Añadir a la cesta

Especificación

Especificación

CNTF Protein
25 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Research Use Only
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Rat
Untagged
Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3.
Videos