missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Ag85B Protein

A cDNA sequence encoding the Ag85B was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10977-2ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15915758

  • 103.00€ / 2 microgramos


Fecha de envío estimada
del proveedor 10-04-2019
Añadir a la cesta

Especificación

Especificación

885785
Greater than 90.0% as determined by SDS-PAGE.
Research Use Only
fbpB
Other
His
Lyophilized with 0.1% glycerol.
Ag85B Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Videos