missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse Noggin Protein

A cDNA sequence encoding the Noggin was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10795-5ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15915198

  • 103.00€ / 5 microgramos


Fecha de envío estimada
del proveedor 09-04-2019
Añadir a la cesta

Especificación

Especificación

Noggin Protein
5 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 M 105 IU/mg in the presence of 5ng/ml BMP-4.
Mouse
Untagged
Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.
Videos