missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PON2 Protein

A cDNA sequence encoding the PON2 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13110-10ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15912539

  • 160.00€ / 10 microgramos


Fecha de envío estimada
del proveedor 21-05-2019
Añadir a la cesta

Especificación

Especificación

PON2 Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
PON2 is supplied in PBS and 50% glycerol.
Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Research Use Only
Recombinant Protein
E. coli
MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ
Videos