missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human p16-INK4a Protein
A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.
Marca: enQuireBio™ QP12946-EC-5ug
Detalles adicionales : Peso : 0.01000kg
Especificaciones
1029 | |
5 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Recombinant Protein | |
E. coli | |
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
p16-INK4a Protein | |
Research Use Only | |
CDKN2A | |
Human | |
Untagged | |
CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4. |