missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human MOG Protein

A cDNA sequence encoding the MOG was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12718-50ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15911329

  • 160.00€ / 50 microgramos


Fecha estimada de envío
20-08-2019
Añadir a la cesta

Especificaciones

Especificaciones

MOG Protein
50 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride.
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
Videos
Documentos