missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human GMFB Protein

A cDNA sequence encoding the GMFB was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12004-1mg

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15919068

  • 5353.00€ / 1 miligramo


Fecha estimada de envío
15-07-2019
Añadir a la cesta

Especificaciones

Especificaciones

GMFB Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
Untagged
The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl.
Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH
Videos