missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human FSH Protein

A cDNA sequence encoding the FSH was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10620-10ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15914438

  • 160.00€ / 10 microgramos


Fecha de envío estimada
del proveedor 09-04-2019
Añadir a la cesta

Especificación

Especificación

FSH Protein
10 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
HEK 293
FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSFSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Greater than 95% as determined by SDS-PAGE.
Research Use Only
The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
Human
Untagged
The recombinant FSH was lyophilized from a concentrated (1 mg/ml) solution containing PBS.
Videos