missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HSV HSV-2 gB Protein

A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12342-100ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15930119

Cantidad Precio
1 181.00€ / 100 microgramos
10 169.00€ / 100 microgramos
Fecha estimada de envío
29-10-2020
Añadir a la cesta


Especificaciones

Especificaciones

HSV HSV-2 gB Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HSV
His
10mM Phosphate buffer pH 7.6 and 75mM NaCl.
Protein is >90% pure as determined by SDS PAGE.
Research Use Only
Recombinant Protein
E. coli
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH
Videos
Documentos