missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HPV HPV 18 Protein

A cDNA sequence encoding the HPV 18 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12308-100ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15920009

  • 183.00€ / 100 microgramos


Fecha de envío estimada
del proveedor 10-04-2019
Añadir a la cesta

Especificación

Especificación

HPV HPV 18 Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HPV
GST
Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Research Use Only
Recombinant Protein
E. coli
VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA
Videos