missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-1 Integrase Protein

A cDNA sequence encoding the HIV-1 Integrase was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12252-100ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15919838

  • 183.00€ / 100 microgramos


Fecha de envío estimada
del proveedor 11-04-2019
Añadir a la cesta

Especificación

Especificación

HIV-1 Integrase Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HIV
His
1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X and 50% Glycerol.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh
Videos