missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis B HBsAg preS2 Protein

A cDNA sequence encoding the HBsAg preS2 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12129-50ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15919468

  • 160.00€ / 50 microgramos


Fecha de envío estimada
del proveedor 05-04-2019
Añadir a la cesta

Especificación

Especificación

Hepatitis B HBsAg preS2 Protein
50 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis B
Untagged
HBsAg protein was lyophilized from 0.2?m filtered (1 mg/ml) solution in 20mM PBS, pH 7.4 and 50mM NaCl.
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN
Videos