missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Helicobacter Pylori Omp Pylori Protein

A cDNA sequence encoding the Omp Pylori was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12926-500ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15911979

  • 691.00€ / 500 microgramos


Fecha de envío estimada
del proveedor 22-05-2019
Añadir a la cesta

Especificación

Especificación

Omp Pylori Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Helicobacter Pylori
Untagged
The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.
Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Research Use Only
Recombinant Protein
E. coli
MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL
Videos