missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ RBMS1 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marca:  Novus Biologicals™ NBP2-57279PEP

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18216262

  • 242.97€ / 100 microlitros
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBMS1. Source: E.coli Amino Acid Sequence: QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP The RBMS1 Recombinant Protein Antigen is derived from E. coli. The RBMS1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Especificaciones

Especificaciones

5937
RBMS1 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4.
chromosome 2 open reading frame 12, DKFZp564H0764, HCC-4, MGC15146, MGC3331, MGC97258, MGC97270, MGC97282, MGC99543, MSSP1, MSSP-1, MSSP-2, MSSP-3, RNA binding motif, single stranded interacting protein 1, SCR2MGC70597, single-stranded-interacting protein
Unlabeled
100μL
E.coli
>80% by SDS-PAGE and Coomassie blue staining
Store at −20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
RBMS1
Recombinant Protein Antigen
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50504. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only.