missing translation for 'onlineSavingsMsg'
Learn More

PSIP1 Recombinant Protein, Abnova

Marca:  Abnova H00011168-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16196302

  • 302.00€ / 10 microgramos


Fecha estimada de envío
19-10-2020
Añadir a la cesta

Descripción

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH33817
Solution
11168
PSIP1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PSIP1
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
31.13
8
Glutathione Sepharose 4 Fast Flow
10 ug
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
DFS70|LEDGF|MGC74712|PAIP|PSIP2|p52|p75
PSIP1
Wheat Germ (in vitro)
GST
Videos
Documentos