missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PRKACA (Human) Recombinant Protein

Human PRKACA full-length ORF ( AAH39846, 1 a.a. - 351 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00005566-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16199531

  • 302.00€ / 10 microgramos


Fecha estimada de envío
23-10-2020
Añadir a la cesta

Descripción

Descripción

  • Sequence: MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Especificaciones

Especificaciones

AAH39846
protein kinase, cAMP-dependent, catalytic, alpha
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PRKACA
GST
5566
Wheat germ expression system
10 μg
MGC102831, MGC48865, PKACA
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documentos