missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ POLR2L (Human) Recombinant Protein

Human POLR2L full-length ORF ( AAH18649, 1 a.a. - 67 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00005441-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16103065

  • 508.00€ / 25 microgramos
Envío estimado: 14-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Especificaciones

Especificaciones

AAH18649
polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
POLR2L
GST
5441
Wheat germ expression system
25 μg
RBP10, RPABC5, RPB10, RPB10beta, RPB7.6, hRPB7.6, hsRPB10b
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales