missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ PKA 2 beta Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marca:  Novus Biologicals™ NBP1-80879PEP

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214799

  • 242.97€ / 0.10 ml
Fecha estimada de envío: 21-08-2024
para ver el stock



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKAR2B. Source: E.coli Amino Acid Sequence: GFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIH The PKA 2 beta Recombinant Protein Antigen is derived from E. coli. The PKA 2 beta Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-80879. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.



PBS and 1M Urea, pH 7.4.
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
PKA 2 beta
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80879. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Sugerencias de productos

Sugerencias de productos



Ofertas especiales

Ofertas especiales

For Research Use Only