missing translation for 'onlineSavingsMsg'
Learn More

PHKG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-56609

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18216344

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

PHKG2 Polyclonal specifically detects PHKG2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Especificaciones

Especificaciones

PHKG2
Polyclonal
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
EC 2.7.11, EC 2.7.11.19, GSD9C, PHK-gamma-T, phosphorylase b kinase gamma catalytic chain, testis/liver isoform, Phosphorylase kinase subunit gamma-2, phosphorylase kinase, gamma 2 (testis), Phosphorylase kinase, gamma 2 (testis/liver), PSK-C3
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
PHKG2
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLY
100 μL
Protein Kinase
5261
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only