missing translation for 'onlineSavingsMsg'
Learn More

PF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-58148

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215661

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock



PF1 Polyclonal specifically detects PF1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.


Immunocytochemistry/Immunofluorescence 1-4 ug/ml
FLJ34122, KIAA1523MGC131914, PF1, PHD factor 1, PHD finger protein 12, PHD zinc finger transcription factor
Affinity Purified
Immunocytochemistry, Immunofluorescence
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSSKRRRKEETTGKNVKKTQHELDHNGLVPLPVKVCFTCNRSCRVAPLIQCDYCPLLFHMDCLEPPLTAMPLGRWMCPNHIEHVVLNQKNMTLS
100 μL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos



Ofertas especiales

Ofertas especiales

For Research Use Only