missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ NUDT2 (Human) Recombinant Protein
Human NUDT2 full-length ORF ( AAH04926, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00000318-P01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
- Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Especificaciones
| AAH04926 | |
| nudix (nucleoside diphosphate linked moiety X)-type motif 2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NUDT2 | |
| GST |
| 318 | |
| Wheat germ expression system | |
| 10 μg | |
| APAH1, MGC10404 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |