missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NUDT2 (Human) Recombinant Protein

Human NUDT2 full-length ORF ( AAH04926, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00000318-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16191641

  • 310.00€ / 10 microgramos


Fecha estimada de envío
24-02-2021
Añadir a la cesta

Descripción

Descripción

  • Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Especificaciones

Especificaciones

AAH04926
nudix (nucleoside diphosphate linked moiety X)-type motif 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NUDT2
GST
318
Wheat germ expression system
10 μg
APAH1, MGC10404
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos