missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NUDT2 (Human) Recombinant Protein

Human NUDT2 full-length ORF ( AAH04926, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00000318-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16101651

  • 518.16€ / 25 microgramos
Envío estimado: 18-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Especificaciones

Especificaciones

AAH04926
nudix (nucleoside diphosphate linked moiety X)-type motif 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NUDT2
GST
318
Wheat germ expression system
25 μg
APAH1, MGC10404
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales