missing translation for 'onlineSavingsMsg'
Learn More

MYST3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-57745

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214101

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

MYST3 Polyclonal specifically detects MYST3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

MYST3
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000
EC 2.3.1.48, EC 3.1.26.4, histone acetyltransferase MYST3, KAT6A, MGC167033, MOZMonocytic leukemia zinc finger protein, MYST histone acetyltransferase (monocytic leukemia) 3, MYST-3, runt-related transcription factor binding protein 2, Runt-related transcription factor-binding protein 2, RUNXBP2, Zinc finger protein 220, ZNF220MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
KAT6A
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSHDTSVVSEQMAGSEDDHEEDSHTKE
100 μL
Epigenetics
7994
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only