missing translation for 'onlineSavingsMsg'
Learn More

MUC1 Antibody, DyLight 650, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP1-60046C

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215931

  • 573.42€ / 0.10 ml
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

Specifically detects MUC-1 in Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat samples, and it is validated for Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting

MUC1 Polyclonal specifically detects MUC1 in Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

MUC-1
Polyclonal
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Q7Z552
MUC1
Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 [NP_001037855]. Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Affinity Purified
RUO
Primary
Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit
IgG
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
DyLight 650
50mM Sodium Borate with 0.05% Sodium Azide
Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin
Rabbit
21 kDa
0.1 mL
Cancer, Cellular Markers, Extracellular Matrix, Inflammation, Signal Transduction
4582
Store at 4C in the dark.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only