missing translation for 'onlineSavingsMsg'
Learn More

MTP18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-57803

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18213492

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

MTP18 Polyclonal specifically detects MTP18 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones

Especificaciones

MTP18
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
HSPC242, Mitochondrial 18 kDa protein, mitochondrial fission process 1, mitochondrial fission process protein 1, mitochondrial protein 18 kDa, MTP18mitochondrial fission protein MTP18
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
MTFP1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA
100 μL
Apoptosis
51537
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only