missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ MTF2 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marca:  Novus Biologicals™ NBP2-55885PEP

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214482

  • 242.97€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTF2. Source: E.coli Amino Acid Sequence: AHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEI The MTF2 Recombinant Protein Antigen is derived from E. coli. The MTF2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.


MTF2 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4.
metal response element binding transcription factor 2, PCL2
>80% by SDS-PAGE and Coomassie blue staining
Store at −20C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Recombinant Protein Antigen
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50785. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Sugerencias de productos

Sugerencias de productos



Ofertas especiales

Ofertas especiales

For Research Use Only