missing translation for 'onlineSavingsMsg'
Learn More

MSRB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 5 publications

Marca:  Bio-Techne NBP1-84259

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18216006

  • 492.43€ / 0.10 ml
Fecha estimada de envío: 14-08-2024
para ver el stock

Descripción

Descripción

MSRB3 Polyclonal specifically detects MSRB3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

MSRB3
Polyclonal
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50
DFNB74, DKFZp686C1178, EC 1.8.4.-, EC 1.8.4.12, FLJ36866, methionine sulfoxide reductase B3, methionine-R-sulfoxide reductase B3, methionine-R-sulfoxide reductase B3, mitochondrial, MsrB3
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
MSRB3
This antibody was developed against Recombinant Protein corresponding to amino acids:QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC
0.1 mL
metabolism
253827
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only