missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MPZ (Human) Recombinant Protein

Human MPZ full-length ORF ( AAH06491.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00004359-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16107941

  • 518.16€ / 25 microgramos
Envío estimado: 20-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
Especificaciones

Especificaciones

AAH06491.1
myelin protein zero
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MPZ
GST
4359
Wheat germ expression system
25 μg
CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, MPP, P0
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales