missing translation for 'onlineSavingsMsg'
Learn More

Methionine Sulfoxide Reductase A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-55671

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18216264

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 14-08-2024
para ver el stock

Descripción

Descripción

Methionine Sulfoxide Reductase A Polyclonal specifically detects Methionine Sulfoxide Reductase A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones

Especificaciones

Methionine Sulfoxide Reductase A
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase
Rabbit
Affinity Purified
RUO
4482
Human
IgG
Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
MSRA
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIK
100 μL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only