missing translation for 'onlineSavingsMsg'
Learn More

LYRIC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Marca:  Bio-Techne NBP1-90328

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18216336

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

LYRIC Polyclonal specifically detects LYRIC in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

LYRIC
Polyclonal
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
3D3, AEG-13D3/LYRIC, AEG1LYRIC/3D3, Astrocyte elevated gene-1 protein, LYRICMetastasis adhesion protein, Lysine-rich CEACAM1 co-isolated protein, metadherin, protein LYRIC
Rabbit
Affinity Purified
RUO
92140
Human, Mouse, Rat
IgG
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
MTDH
This antibody was developed against Recombinant Protein corresponding to amino acids:RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQD
0.1 mL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only