missing translation for 'onlineSavingsMsg'
Learn More

LPHN1 Recombinant Protein, Abnova

Marca:  Abnova H00022859-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16196662

  • 302.00€ / 10 microgramos


Fecha estimada de envío
19-10-2020
Añadir a la cesta

Descripción

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH19928
Solution
22859
LPHN1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LPHN1
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
48.2
8
Glutathione Sepharose 4 Fast Flow
10 ug
MGLASHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC
CIRL1|CL1|LEC2
LPHN1
Wheat Germ (in vitro)
GST
Videos
Documentos