Abnova™ KLK3 (Human) Recombinant Protein

Name: Abnova&trade; KLK3 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16101741
Price: 335.00 EUR

Human KLK3 full-length ORF ( AAH05307, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

Marca: Abnova™ H00000354-P01.10ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16101741

Fecha estimada de envío: 31-05-2024
para ver el stock

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDVSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKLMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Especificaciones

Número de acceso	AAH05307
Nombre	kallikrein-related peptidase 3
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	KLK3
Etiqueta de proteína	GST

ID de gen (Entrez)	354
Método de preparación	Wheat germ expression system
Cantidad	10 μg
Alias de gen	APS, KLK2A1, PSA, hK3
Especie	Wheat Germ (in vitro)
Tampón	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Sugerencias de productos

Descripción