missing translation for 'onlineSavingsMsg'
Learn More

Keap1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Marca:  Bio-Techne NBP1-83106

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18214828

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

Keap1 Polyclonal specifically detects Keap1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

Keap1
Polyclonal
Western Blot Reported in scientific literature (PMID: 30632210)., Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
INRF2, INrf2MGC9454, kelch-like ECH-associated protein 1, Kelch-like protein 19, KIAA0132MGC4407, KLHL19Cytosolic inhibitor of Nrf2, MGC10630, MGC1114, MGC20887
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
KEAP1
This antibody was developed against Recombinant Protein corresponding to amino acids:MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVM
0.1 mL
Stem Cell Markers
9817
Human, Mouse
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only