missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ KBTBD8 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marca:  Novus Biologicals™ NBP2-56273PEP

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215474

  • 242.97€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KBTBD8. Source: E.coli Amino Acid Sequence: NKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHVFRTSRKNSLYQYDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQK The KBTBD8 Recombinant Protein Antigen is derived from E. coli. The KBTBD8 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.


KBTBD8 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4.
kelch repeat and BTB (POZ) domain containing 8, KIAA1842, TAKRP, T-cell activation kelch repeat protein
>80% by SDS-PAGE and Coomassie blue staining
Store at −20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Recombinant Protein Antigen
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50788. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Sugerencias de productos

Sugerencias de productos



Ofertas especiales

Ofertas especiales

For Research Use Only.