missing translation for 'onlineSavingsMsg'
Learn More

IL-11R alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-69375

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214552

  • 471.91€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

IL-11R alpha Polyclonal antibody specifically detects IL-11R alpha in Human, Mouse samples. It is validated for Western Blot.
Especificaciones

Especificaciones

IL-11R alpha
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
IL-11 receptor subunit alpha, IL-11R subunit alpha, IL-11RA, IL-11R-alpha, interleukin 11 receptor, alpha, interleukin-11 receptor alpha chain, interleukin-11 receptor subunit alpha, MGC2146
Rabbit
43 kDa
100 μL
Cytokine Research, Immunology, Innate Immunity
3590
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q14626
IL11RA
Synthetic peptides corresponding to IL11RA(interleukin 11 receptor, alpha) The peptide sequence was selected from the N terminal of IL11RA. Peptide sequence QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGAD.
Affinity purified
RUO
Primary
This product is specific to Subunit or Isoform: alpha.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only