missing translation for 'onlineSavingsMsg'
Learn More

IFT52 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-55756

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18216202

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

IFT52 Polyclonal specifically detects IFT52 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

IFT52
Polyclonal
Immunohistochemistry-Paraffin 1:1000 - 1:2500
CGI-53, chromosome 20 open reading frame 9, dJ1028D15.1, intraflagellar transport 52 homolog (Chlamydomonas), intraflagellar transport protein 52 homolog, NGD2, NGD5C20orf9, Protein NGD5 homolog
Rabbit
Affinity Purified
RUO
51098
Human
IgG
Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
IFT52
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDA
100 μL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only