missing translation for 'onlineSavingsMsg'
Learn More

IBRDC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-88253

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214217

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

IBRDC1 Polyclonal specifically detects IBRDC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

IBRDC1
Polyclonal
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
C6orf172, chromosome 6 open reading frame 172, dJ84N20.1, EC 6.3.2.-, IBR domain containing 1, IBRDC1, MGC26996, probable E3 ubiquitin-protein ligase RNF217, ring finger protein 217IBR domain-containing protein 1
Rabbit
Affinity Purified
RUO
154214
Human
IgG
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
RNF217
This antibody was developed against Recombinant Protein corresponding to amino acids:GQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKK
0.1 mL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only