missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF137 Partial ORF (NP_003429.1, 101 a.a. - 206 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00007696-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16197825

  • 302.00€ / 10 microgramos


Fecha estimada de envío
27-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: KCNKCGKIFRHRSYLAVYQRTHTGEKPYKYHDCGKVFSQASSYAKHRRIHTGEKPHKCDDCGKVLTSRSHLIRHQRIHTGQKSYKCLKCGKVFSLWALHAEHQKIH
Especificaciones

Especificaciones

NP_003429.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.4kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KCNKCGKIFRHRSYLAVYQRTHTGEKPYKYHDCGKVFSQASSYAKHRRIHTGEKPHKCDDCGKVLTSRSHLIRHQRIHTGQKSYKCLKCGKVFSLWALHAEHQKIH
RUO
ZNF137
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7696
ZNF137 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC119990|MGC119991|pHZ-30
ZNF137
Yes
Videos
Documentos