missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human WTAP Partial ORF (NP_690596.1, 70 a.a. - 151 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00009589-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16101006

  • 518.16€ / 25 microgramos
Envío estimado: 18-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in three transcript variants, two of which encode the same isoform. [provided by RefSeq]

Sequence: ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR
Especificaciones

Especificaciones

NP_690596.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.76kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR
RUO
WTAP
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9589
WTAP (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686F20131/KIAA0105/MGC3925
WTAP
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales