missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human WFDC3 Full-length ORF (AAH26014.2, 1 a.a. - 48 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00140686-P01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The encoded protein contains four WFDC domains. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Alternatively spliced transcript variants have been observed but their full-length nature has not been determined. [provided by RefSeq]
Sequence: MDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVPEspecificaciones
| AAH26014.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.7kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| WAP14/dJ447F3.3 | |
| WFDC3 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 140686 | |
| WFDC3 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP | |
| RUO | |
| WFDC3 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |