missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TSFM Partial ORF (NP_005717, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010102-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16101856

  • 335.00€ / 10 microgramos
Envío estimado: 14-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Synthesis of the 13 mitochondrial-encoded proteins occurs on a dedicated mitochondrial translation apparatus similar to that found in prokaryotes and requires, in addition to the tRNAs and rRNAs encoded in mtDNA, the concerted action of several translation factors and a large number of mitochondrial ribosomal proteins, all of which are encoded by nuclear genes. The TSFM gene encodes a mitochondrial translation elongation factor (Smeitink et al., 2006 [PubMed 17033963]).[supplied by OMIM]

Sequence: MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGR
Especificaciones

Especificaciones

NP_005717
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGR
RUO
TSFM
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10102
TSFM (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
COXPD3/EF-TS/EF-Tsmt
TSFM
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales