missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TRIM16 Partial ORF (NP_006461, 165 a.a. - 273 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70€ - 518.16€

Especificaciones

Nombre TRIM16 (Human) Recombinant Protein (Q01)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 37.73kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16105452
Ver documentos Detalles de la promoción
Abnova™
H00010626-Q01.10UG
10 ug
341.70€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 15-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16115452
Ver documentos Detalles de la promoción
Abnova™
H00010626-Q01.25UG
25 ug
518.16€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 15-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined. [provided by RefSeq]

Sequence: LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
Especificaciones

Especificaciones

TRIM16 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
37.73kDa
SDS
Product Certifications