missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TP53BP2 Partial ORF (AAH58918, 511 a.a. - 610 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70€ - 518.16€

Especificaciones

Nombre TP53BP2 (Human) Recombinant Protein (Q01)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 36.41kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16196865
Ver documentos Detalles de la promoción
Abnova™
H00007159-Q01.10UG
10 ug
341.70€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 08-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16106875
Ver documentos Detalles de la promoción
Abnova™
H00007159-Q01.25UG
25 ug
518.16€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 08-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS
Especificaciones

Especificaciones

TP53BP2 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.41kDa
SDS
Product Certifications