missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TNP1 Partial ORF (NP_003275.1, 1 a.a. - 55 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00007141-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16106835

  • 341.70€ / 10 microgramos
Envío estimado: 24-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM]

Sequence: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Especificaciones

Especificaciones

NP_003275.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.79kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
RUO
TNP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7141
TNP1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TP1
TNP1
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales