missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TMSB4Y Full-length ORF (NP_004193.1, 1 a.a. - 44 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00009087-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16103272

  • 335.00€ / 10 microgramos
Envío estimado: 14-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene lies within the male specific region of chromosome Y. Its homolog on chromosome X escapes X inactivation and encodes an actin sequestering protein. [provided by RefSeq]

Sequence: MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
Especificaciones

Especificaciones

NP_004193.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.4kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC26307/TB4Y
TMSB4Y
Yes
wheat germ expression system
Liquid
9087
TMSB4Y (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
RUO
TMSB4Y
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales