Learn More
Abnova™ Human TMSB4X Full-length ORF (NP_066932, 1 a.a. - 44 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00007114-P02.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq]
Sequence: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGESEspecificaciones
| NP_066932 | |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 30.58kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FX|PTMB4|TB4X|TMSB4 | |
| TMSB4X | |
| Yes |
| wheat germ expression system | |
| Liquid | |
| 7114 | |
| TMSB4X (Human) Recombinant Protein (P02) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | |
| RUO | |
| TMSB4X | |
| Wheat Germ (in vitro) | |
| GST |