missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SUCLG2 Full-length ORF (NP_003839.1, 1 a.a. - 384 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00008801-P01.25ug

Detalles adicionales : Peso : 0.00010kg


 Ver más versiones de este producto

Código de producto. 16192912

  • 467.00€ / 25 microgramos


Fecha estimada de envío
17-02-2021
Añadir a la cesta

Descripción

Descripción

Sequence: MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK
Especificaciones

Especificaciones

NP_003839.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
67.6kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
G-BETA
SUCLG2
Yes
wheat germ expression system
Liquid
8801
SUCLG2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK
RUO
SUCLG2
Wheat Germ (in vitro)
GST
Videos
Seguridad y manipulación

Seguridad y manipulación

Nombre del producto
  • SUCLG2 (Human) Recombinant Protein (P01)

Palabra de advertencia
  • Atención

Clasificación
  • Toxicidad aguda Categoría 4
  • Lesión ocular grave/irritación ocular Categoría 2
  • Corrosión o irritación cutáneas Categoría 2

Indicaciones de peligro
  • H302-Nocivo en caso de ingestión.
  • H312-Nocivo en contacto con la piel.
  • H319-Provoca irritación ocular grave.

Consejos de prudencia
  • P102-Mantener fuera del alcance de los niños.
  • P103-Leer la etiqueta antes del uso.
  • P233-Mantener el recipiente herméticamente cerrado.
  • P270-No comer, beber ni fumar durante su utilización.
  • P301+P310-EN CASO DE INGESTIÓN: Llamar inmediatamente a un CENTRO DE TOXICOLOG A/médico/.
  • P303+P361+P353-EN CASO DE CONTACTO CON LA PIEL (o el pelo): Quitar inmediatamente todas las prendas contaminadas. Aclararse la piel con agua/ducharse.
  • P305+P351+P338-EN CASO DE CONTACTO CON LOS OJOS: Aclarar cuidadosamente con agua durante varios minutos. Quitar las lentes de contacto, si lleva y resulta fácil. Seguir aclarando.
  • P404-Almacenar en un recipiente cerrado.
  • P501b-Eliminar el contenido/el recipiente en conforme a la reglamentación local/regional/nacional/internacional.

Otros peligros
  • MIXTURE LIST-Contém: reduced glutathione,tris-HCl

SDS
Documentos