missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLURP1 Partial ORF (NP_065160, 25 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00057152-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16109036

  • 518.16€ / 25 microgramos
Envío estimado: 25-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq]

Sequence: CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE
Especificaciones

Especificaciones

NP_065160
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.32kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE
RUO
SLURP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
57152
SLURP1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ANUP/ARS/ArsB/LY6LS/MDM
SLURP1
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales