missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC2A4 Partial ORF (NP_001033, 467 a.a. - 509 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00006517-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16105375

  • 341.70€ / 10 microgramos
Envío estimado: 25-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq]

Sequence: RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Especificaciones

Especificaciones

NP_001033
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
30.47kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
RUO
SLC2A4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6517
SLC2A4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GLUT4
SLC2A4
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales